ads-securities.com alexa rank chart, ads-securities.com alexa rank daily changes

ads-securities.com alexa rank chart, ads-securities.com alexa rank daily changes

ads-securities.com
Actual rank:
537 676

RANK HISTORY

Date Rank Diff
2018/04/20 537 676 -340 012
2018/04/19 877 688 +589 989
2018/04/18 287 699 -1 214
2018/04/17 288 913 -472 706
2018/04/16 761 619 +464 243
2018/04/15 297 376 +1 808
2018/04/14 295 568 +108 109
2018/04/13 187 459 -17 163
2018/04/12 204 622 -177 333
2018/04/11 381 955 +3 301
2018/04/10 378 654 +198 959
2018/04/08 179 695 -118 077
2018/04/07 297 772 -117 517
2018/04/06 415 289 +169 795
2018/04/05 245 494 +54 639
2018/04/04 190 855 -263 107
2018/04/01 453 962 +129 480
2018/03/31 324 482 +104 885
2018/03/30 219 597 -62 140
2018/03/29 281 737 +58 024
2018/03/28 223 713 -5 495
2018/03/26 229 208 -75 860
2018/03/25 305 068 -145 664
2018/03/24 450 732 +170 457
2018/03/23 280 275 -126 260
2018/03/22 406 535 +157 594
2018/03/21 248 941 -10 193
2018/03/20 259 134 -99 624
2018/03/19 358 758 +103 971
2018/03/18 254 787 -127 908
2018/03/17 382 695 -245 004
2018/03/16 627 699 +332 710
2018/03/15 294 989 +81 121
2018/03/14 213 868 -593 442
2018/03/13 807 310 +616 368
2018/03/12 190 942 -40 835
2018/03/11 231 777 -104 557
2018/03/10 336 334 +35 851
2018/03/09 300 483 -34 875
2018/03/08 335 358 +202 819
2018/03/07 132 539 -187 631
2018/03/06 320 170 -17 162
2018/03/05 337 332 +60 829
2018/03/04 276 503 +74 380
2018/03/03 202 123 -169 753
2018/03/02 371 876 -199 810
2018/03/01 571 686 +268 990
2018/02/28 302 696 -691 412
2018/02/26 994 108 +639 885
2018/02/25 354 223 +108 656
2018/02/24 245 567 -103 671
2018/02/23 349 238 -10 661
2018/02/22 359 899 +51 364
2018/02/21 308 535 -365 747
2018/02/20 674 282 +426 905
2018/02/19 247 377

WIDGET FOR YOUR SITE

DOMAINS WITH THE NEAREST RANK

Domain Rank
flag.org 537 671
multzona.ru 537 672
18teenbox.com 537 673
q328wgvbvfj8ge.ru 537 674
megafanatico.com 537 675
ads-securities.com 537 676
elmag.me 537 677
xxxclipspornvips.top 537 678
atma.md 537 679
crististefan.com 537 680
2h.com.hk 537 681

DOMAINS WITH THE NEAREST RANK BY TLD .com

Domain Rank
fungaru.com 537 664
previewsitesmediasmacksiteserver.com 537 666
purastays.com 537 667
18teenbox.com 537 673
megafanatico.com 537 675
ads-securities.com 537 676
crististefan.com 537 680
adoninas.com 537 682
martinbonari.com 537 685
ricambiamerica.com 537 687
migjimenez.com 537 691