alexpix.com alexa rank chart, alexpix.com alexa rank daily changes

alexpix.com alexa rank chart, alexpix.com alexa rank daily changes

alexpix.com
Actual rank:
293 105

RANK HISTORY

Date Rank Diff
2017/09/26 293 105 -5 091
2017/09/25 298 196 -223
2017/09/24 298 419 +3 626
2017/09/23 294 793 -1 987
2017/09/22 296 780 -932
2017/09/20 297 712 +5 421
2017/09/19 292 291 -3 729
2017/09/18 296 020 -3 891
2017/09/17 299 911 -3 893
2017/09/16 303 804 -4 566
2017/09/15 308 370 +17 259
2017/09/14 291 111 -1 630
2017/09/13 292 741 -6 854
2017/09/12 299 595 +1 643
2017/09/11 297 952 -14 046
2017/09/10 311 998 -9 536
2017/09/09 321 534 +10 875
2017/09/08 310 659 -2 958
2017/09/07 313 617 +10 910
2017/09/06 302 707 -30 573
2017/09/05 333 280 -3 822
2017/09/04 337 102 -9 772
2017/09/03 346 874 -5 799
2017/09/02 352 673 +6 919
2017/09/01 345 754 -71
2017/08/31 345 825 +7 714
2017/08/30 338 111 -1 211
2017/08/29 339 322 +5 585
2017/08/28 333 737 -11 430
2017/08/27 345 167 -1 355
2017/08/26 346 522 -2 343
2017/08/25 348 865 +5 651
2017/08/24 343 214 -5 272
2017/08/23 348 486 -1 327
2017/08/22 349 813 -16 692
2017/08/21 366 505 +3 263
2017/08/20 363 242 -4 746
2017/08/19 367 988 +350
2017/08/18 367 638 +8 425
2017/08/17 359 213 +10 445
2017/08/16 348 768 +14 962
2017/08/15 333 806 -26 096
2017/08/14 359 902 -9 586
2017/08/13 369 488 -3 091
2017/08/12 372 579 +4 758
2017/08/11 367 821 +12 245
2017/08/10 355 576 +8 578
2017/08/09 346 998 -10 749
2017/08/08 357 747 +1 757
2017/08/07 355 990 -3 986
2017/08/06 359 976 +2 846
2017/08/05 357 130 -2 009
2017/08/04 359 139 -3 392
2017/08/03 362 531 +39 825
2017/08/02 322 706 -889
2017/08/01 323 595 +4 086
2017/07/31 319 509 -3 428
2017/07/30 322 937 -55
2017/07/29 322 992 -2 311
2017/07/28 325 303

WIDGET FOR YOUR SITE

DOMAINS WITH THE NEAREST RANK

Domain Rank
nb-bet.com 293 100
zhuanyewanjia.com 293 101
viralymedio.com 293 102
javea.com 293 103
dainikrojgar.com 293 104
alexpix.com 293 105
bigbootytube.xxx 293 106
actividadesdeinfantilyprimaria.com 293 107
flyamo.de 293 108
visualpharm.com 293 109
fashion71.net 293 110

DOMAINS WITH THE NEAREST RANK BY TLD .com

Domain Rank
nb-bet.com 293 100
zhuanyewanjia.com 293 101
viralymedio.com 293 102
javea.com 293 103
dainikrojgar.com 293 104
alexpix.com 293 105
actividadesdeinfantilyprimaria.com 293 107
visualpharm.com 293 109
attacheonline.com 293 111
hotmit.com 293 112
asecuritysite.com 293 113