assdae.com alexa rank chart, assdae.com alexa rank daily changes

assdae.com alexa rank chart, assdae.com alexa rank daily changes

assdae.com
Actual rank:
370 757

RANK HISTORY

Date Rank Diff
2017/10/18 370 757 -538
2017/10/17 371 295 -1 863
2017/10/16 373 158 +9 931
2017/10/14 363 227 -3 582
2017/10/13 366 809 +1 140
2017/10/12 365 669 -1 372
2017/10/11 367 041 -254
2017/10/10 367 295 -2 310
2017/10/09 369 605 +2 036
2017/10/08 367 569 -1 191
2017/10/07 368 760 -6 025
2017/10/06 374 785 +5 595
2017/10/05 369 190 +3 586
2017/10/04 365 604 -9 999
2017/10/03 375 603 +430
2017/10/02 375 173 -228
2017/10/01 375 401 -7 056
2017/09/30 382 457 +2 151
2017/09/29 380 306 -6 241
2017/09/28 386 547 +2 141
2017/09/27 384 406 +15 599
2017/09/26 368 807 -11 464
2017/09/25 380 271 +10 488
2017/09/24 369 783 -7 842
2017/09/23 377 625 +4 564
2017/09/22 373 061 -357
2017/09/20 373 418 +11 457
2017/09/19 361 961 +6 951
2017/09/18 355 010 +7 864
2017/09/17 347 146 +9 926
2017/09/16 337 220 -9 024
2017/09/15 346 244 +9 697
2017/09/14 336 547 +7 114
2017/09/13 329 433 -5 545
2017/09/12 334 978 -11
2017/09/11 334 989 +1 688
2017/09/10 333 301 +10 187
2017/09/09 323 114 +2 232
2017/09/08 320 882 +1 469
2017/09/07 319 413 +2 447
2017/09/06 316 966 -5 155
2017/09/05 322 121 -1 200
2017/09/04 323 321 +6 626
2017/09/03 316 695 -8 682
2017/09/02 325 377 +3 798
2017/09/01 321 579 +3 006
2017/08/31 318 573 +427
2017/08/30 318 146 -2 227
2017/08/29 320 373 -1 683
2017/08/28 322 056 -3 476
2017/08/27 325 532 -7 883
2017/08/26 333 415 +752
2017/08/25 332 663 +10 290
2017/08/24 322 373 +8 592
2017/08/23 313 781 -2 468
2017/08/22 316 249 +4 371
2017/08/21 311 878 +1 703
2017/08/20 310 175 -2 057
2017/08/19 312 232

WIDGET FOR YOUR SITE

DOMAINS WITH THE NEAREST RANK

Domain Rank
drgourmet.com 370 752
switchtop.com 370 753
autouncle.pt 370 754
netmeter.co.uk 370 755
actividadesdeinfantilyprimaria.com 370 756
assdae.com 370 757
trundlerbpndrsqg.download 370 758
nexteamspeak.de 370 759
haasf1team.com 370 760
kaizu.land 370 761
dahnworld.com 370 762

DOMAINS WITH THE NEAREST RANK BY TLD .com

Domain Rank
usekahuna.com 370 750
myarenaonline.com 370 751
drgourmet.com 370 752
switchtop.com 370 753
actividadesdeinfantilyprimaria.com 370 756
assdae.com 370 757
haasf1team.com 370 760
dahnworld.com 370 762
knowledgevision.com 370 763
relampagomovies.com 370 764
chilloutkorea.com 370 765