botw.org alexa rank chart, botw.org alexa rank daily changes

botw.org alexa rank chart, botw.org alexa rank daily changes

botw.org
Actual rank:
160 670

RANK HISTORY

Date Rank Diff
2018/02/18 160 670 -42 575
2018/02/17 203 245 -178 821
2018/02/16 382 066 +209 869
2018/02/15 172 197 -55 386
2018/02/14 227 583 +57 691
2018/02/13 169 892 -307 777
2018/02/12 477 669 +194 924
2018/02/11 282 745 -13 449
2018/02/10 296 194 -105 846
2018/02/09 402 040 +84 482
2018/02/08 317 558 -345 294
2018/02/07 662 852 +355 283
2018/02/06 307 569 +41 368
2018/02/05 266 201 +48 843
2018/02/04 217 358 -22 312
2018/02/03 239 670 +111 814
2018/02/02 127 856 -155 902
2018/02/01 283 758 +120 624
2018/01/31 163 134 -61 663
2018/01/30 224 797 -690
2018/01/29 225 487 -1 828
2018/01/28 227 315 -1 748
2018/01/27 229 063 -1 848
2018/01/26 230 911 -8 750
2018/01/25 239 661 -6 640
2018/01/24 246 301 -148
2018/01/23 246 449 +103
2018/01/22 246 346 +371
2018/01/21 245 975 -5 742
2018/01/20 251 717 +3 094
2018/01/19 248 623 -10 955
2018/01/18 259 578 -3 312
2018/01/17 262 890 +5 864
2018/01/16 257 026 +4 114
2018/01/15 252 912 +8 240
2018/01/14 244 672 +3 708
2018/01/13 240 964 +2 633
2018/01/12 238 331 -5 850
2018/01/11 244 181 -3 908
2018/01/10 248 089 +3 548
2018/01/09 244 541 +6 577
2018/01/08 237 964 +9 053
2018/01/07 228 911 -2 705
2018/01/06 231 616 +7 912
2018/01/05 223 704 +1 037
2018/01/04 222 667 -1 553
2018/01/03 224 220 -2 018
2018/01/02 226 238 +7 624
2018/01/01 218 614 +1 928
2017/12/31 216 686 -1 310
2017/12/30 217 996 +12 590
2017/12/29 205 406 +11 419
2017/12/28 193 987 +2 273
2017/12/27 191 714 +4 052
2017/12/26 187 662 +2 592
2017/12/25 185 070 +309
2017/12/24 184 761 +3 829
2017/12/23 180 932 +11 470
2017/12/22 169 462 +3 645
2017/12/21 165 817 +1 239
2017/12/20 164 578

WIDGET FOR YOUR SITE

DOMAINS WITH THE NEAREST RANK

Domain Rank
diariopresente.mx 160 665
actividadesdeinfantilyprimaria.com 160 666
alamy.es 160 667
videogamegeek.com 160 668
dmoztools.net 160 669
botw.org 160 670
thyroidpharmacist.com 160 671
alcatel-mobile.com.br 160 672
baixefilmeshd.comunidades.net 160 673
consultec.com.br 160 674
jaenoticia.com.br 160 675

DOMAINS WITH THE NEAREST RANK BY TLD .org

Domain Rank
ithacacityschools.org 160 530
summitfcu.org 160 546
egyptscholars.org 160 563
artelgroup.org 160 577
himssconference.org 160 616
botw.org 160 670
cricfree.org 160 687
enable-cors.org 160 702
torrent9.org 160 710
harvest.org 160 729
piloter.org 160 738