davisnet.com alexa rank chart, davisnet.com alexa rank daily changes

davisnet.com alexa rank chart, davisnet.com alexa rank daily changes

davisnet.com
Actual rank:
316 519

RANK HISTORY

Date Rank Diff
2017/01/22 316 519 +4 492
2017/01/20 312 027 +1 751
2017/01/19 310 276 +244
2017/01/18 310 032 -2 723
2017/01/17 312 755 -3 096
2017/01/16 315 851 +941
2017/01/15 314 910 +6 713
2017/01/14 308 197 +1 556
2017/01/13 306 641 +2 040
2017/01/12 304 601 -1 297
2017/01/11 305 898 -9 385
2017/01/10 315 283 -3 108
2017/01/09 318 391 +3 328
2017/01/08 315 063 -1 994
2017/01/07 317 057 +4 567
2017/01/06 312 490 -5 590
2017/01/05 318 080 +113
2017/01/04 317 967 -5 854
2017/01/03 323 821 -921
2017/01/02 324 742 +11 785
2017/01/01 312 957 -110
2016/12/31 313 067 -1 576
2016/12/30 314 643 -1 193
2016/12/29 315 836 +106
2016/12/28 315 730 +5 760
2016/12/27 309 970 +397
2016/12/26 309 573 -2 127
2016/12/25 311 700 -4 486
2016/12/24 316 186 +8 604
2016/12/23 307 582 +319
2016/12/22 307 263 +7 626
2016/12/21 299 637 -6 586
2016/12/20 306 223 +7 755
2016/12/19 298 468 -5 752
2016/12/18 304 220 -4 770
2016/12/17 308 990 -5 297
2016/12/16 314 287 +285
2016/12/15 314 002 -16 289
2016/12/14 330 291 -5 284
2016/12/13 335 575 -3 088
2016/12/12 338 663 +4 242
2016/12/11 334 421 -12 169
2016/12/10 346 590 -5 722
2016/12/09 352 312 +7 886
2016/12/08 344 426 -1 455
2016/12/07 345 881 -12 757
2016/12/06 358 638 -9 654
2016/12/05 368 292 -11 391
2016/12/04 379 683 +828
2016/12/02 378 855 -15 977
2016/12/01 394 832 +19 140
2016/11/30 375 692 +2 221
2016/11/29 373 471 -7 892
2016/11/28 381 363 -13 633
2016/11/27 394 996 -15 195
2016/11/26 410 191 -4 154
2016/11/25 414 345 -5 136
2016/11/24 419 481 +5 667
2016/11/23 413 814

WIDGET FOR YOUR SITE

DOMAINS WITH THE NEAREST RANK

Domain Rank
checkingfreefreesafesystems.website 316 514
wpfree.org 316 515
thebuxer.com 316 516
magazetini.com 316 517
pictometry.com 316 518
davisnet.com 316 519
19k19k.cn 316 520
ekupi.rs 316 521
edugeneral.org 316 522
gqy.com.cn 316 523
yutori-kun.com 316 524

DOMAINS WITH THE NEAREST RANK BY TLD .com

Domain Rank
allclients.com 316 512
ezgo.com 316 513
thebuxer.com 316 516
magazetini.com 316 517
pictometry.com 316 518
davisnet.com 316 519
yutori-kun.com 316 524
anysdk.com 316 528
albrq-games.com 316 529
c4defence.com 316 531
firmhandspanking.com 316 532