digsdigs.com alexa rank chart, digsdigs.com alexa rank daily changes

digsdigs.com alexa rank chart, digsdigs.com alexa rank daily changes

digsdigs.com
Actual rank:
219 125

RANK HISTORY

Date Rank Diff
2018/04/19 219 125 +145 151
2018/04/18 73 974 -78 967
2018/04/17 152 941 -53 528
2018/04/16 206 469 +34 364
2018/04/15 172 105 -25 283
2018/04/14 197 388 +56 611
2018/04/13 140 777 -97 474
2018/04/12 238 251 +121 670
2018/04/11 116 581 -101 178
2018/04/10 217 759 +124 781
2018/04/09 92 978 -121 536
2018/04/08 214 514 -35 546
2018/04/07 250 060 +31 353
2018/04/06 218 707 +83 394
2018/04/05 135 313 -65 628
2018/04/04 200 941 +99 091
2018/04/03 101 850 -318 910
2018/04/02 420 760 +288 632
2018/04/01 132 128 +17 985
2018/03/31 114 143 -43 970
2018/03/30 158 113 -50 465
2018/03/29 208 578 +75 434
2018/03/28 133 144 +8 417
2018/03/27 124 727 -161 089
2018/03/26 285 816 +74 469
2018/03/25 211 347 -4 326
2018/03/24 215 673 -32 147
2018/03/23 247 820 +75 612
2018/03/22 172 208 +5 103
2018/03/21 167 105 -42 072
2018/03/20 209 177 +106 459
2018/03/19 102 718 +56 705
2018/03/18 46 013 -279 082
2018/03/17 325 095 +187 683
2018/03/16 137 412 -49 233
2018/03/15 186 645 +107 115
2018/03/14 79 530 -100 933
2018/03/13 180 463 -81 031
2018/03/12 261 494 +142 409
2018/03/11 119 085 +30 024
2018/03/10 89 061 -350 560
2018/03/09 439 621 +233 385
2018/03/08 206 236 -71 719
2018/03/07 277 955 +69 169
2018/03/06 208 786 -151 395
2018/03/05 360 181 +54 699
2018/03/04 305 482 +97 453
2018/03/03 208 029 -53 579
2018/03/02 261 608 +54 134
2018/03/01 207 474 +60 408
2018/02/28 147 066 +20 104
2018/02/27 126 962 -207 263
2018/02/26 334 225 -170 124
2018/02/25 504 349 +267 348
2018/02/24 237 001 -93 121
2018/02/23 330 122 +161 766
2018/02/22 168 356 +55 046
2018/02/21 113 310 -100 130
2018/02/20 213 440 +116 106
2018/02/19 97 334 -144 319
2018/02/18 241 653

WIDGET FOR YOUR SITE

DOMAINS WITH THE NEAREST RANK

Domain Rank
herrschners.com 219 120
spud.ca 219 121
kinofototeh.ucoz.ru 219 122
tfile-search.org 219 123
telusmobility.com 219 124
digsdigs.com 219 125
communicationtheory.org 219 126
toyota.co.nz 219 127
actividadesdeinfantilyprimaria.com 219 128
paidtoclick.in 219 129
classkick.com 219 130

DOMAINS WITH THE NEAREST RANK BY TLD .com

Domain Rank
helpbit.com 219 115
speak7.com 219 116
wwaytv3.com 219 117
herrschners.com 219 120
telusmobility.com 219 124
digsdigs.com 219 125
actividadesdeinfantilyprimaria.com 219 128
classkick.com 219 130
playkot.com 219 135
talkwithlead.com 219 138
seekexplained.com 219 140