freetechbooks.com alexa rank chart, freetechbooks.com alexa rank daily changes

freetechbooks.com alexa rank chart, freetechbooks.com alexa rank daily changes

freetechbooks.com
Actual rank:
463 035

RANK HISTORY

Date Rank Diff
2018/06/21 463 035 -174 190
2018/06/20 637 225 +307 633
2018/06/19 329 592 +167 080
2018/06/18 162 512 -587 683
2018/06/17 750 195 +482 513
2018/06/16 267 682 -100 592
2018/06/15 368 274 +135 278
2018/06/14 232 996 -278 945
2018/06/13 511 941 +198 997
2018/06/11 312 944 +43 582
2018/06/10 269 362 +65 426
2018/06/09 203 936 -56 442
2018/06/08 260 378 -164 399
2018/06/07 424 777 +222 192
2018/06/06 202 585 -125 748
2018/06/05 328 333 +151 761
2018/06/04 176 572 -69 751
2018/06/03 246 323 +163 714
2018/06/02 82 609 -183 510
2018/06/01 266 119 +150 496
2018/05/31 115 623 -193 114
2018/05/29 308 737 -28 390
2018/05/28 337 127 -122 402
2018/05/27 459 529 +271 348
2018/05/26 188 181 -310 982
2018/05/25 499 163 +429 273
2018/05/24 69 890 -5 606
2018/05/23 75 496 -252 976
2018/05/22 328 472 +98 616
2018/05/21 229 856 +29 089
2018/05/20 200 767 -262 473
2018/05/19 463 240 +99 475
2018/05/18 363 765 +232 754
2018/05/17 131 011 -760 342
2018/05/16 891 353 +731 301
2018/05/15 160 052 -52 509
2018/05/14 212 561 +17 955
2018/05/13 194 606 -108 364
2018/05/11 302 970 +77 173
2018/05/10 225 797 -81 769
2018/05/09 307 566 +240 647
2018/05/08 66 919 -27 143
2018/05/07 94 062 -31 250
2018/05/06 125 312 +9 301
2018/05/05 116 011 -61 068
2018/05/04 177 079 -295 081
2018/05/03 472 160 +341 975
2018/05/01 130 185 -183 908
2018/04/30 314 093 -277 545
2018/04/29 591 638 +392 664
2018/04/28 198 974 -10 755
2018/04/27 209 729 +111 426
2018/04/26 98 303 -113 244
2018/04/25 211 547 +38 879
2018/04/24 172 668 -37 061
2018/04/23 209 729 -111 250
2018/04/22 320 979

WIDGET FOR YOUR SITE

DOMAINS WITH THE NEAREST RANK

Domain Rank
sitecomlearningcentre.com 463 030
previewsitesmediasmacksiteserver.com 463 031
tikag.com 463 032
zionmarketresearch.com 463 033
lopngoaingu.com 463 034
freetechbooks.com 463 035
lucyzara.com 463 036
alpa.cz 463 037
quantum-soft.net 463 038
smmcraft.ru 463 039
sexygirlfriend-pics.com 463 040

DOMAINS WITH THE NEAREST RANK BY TLD .com

Domain Rank
sitecomlearningcentre.com 463 030
previewsitesmediasmacksiteserver.com 463 031
tikag.com 463 032
zionmarketresearch.com 463 033
lopngoaingu.com 463 034
freetechbooks.com 463 035
lucyzara.com 463 036
sexygirlfriend-pics.com 463 040
ghanacinema.com 463 041
paiindustries.com 463 042
toplop.com 463 043