info-mapping.com alexa rank chart, info-mapping.com alexa rank daily changes

info-mapping.com alexa rank chart, info-mapping.com alexa rank daily changes

info-mapping.com
Actual rank:
353 944

RANK HISTORY

Date Rank Diff
2017/08/22 353 944 -66 288
2017/08/21 420 232 -10 800
2017/08/20 431 032 +58 111
2017/08/19 372 921 -389
2017/08/18 373 310 -2 577
2017/08/17 375 887 -24 011
2017/08/16 399 898 +103
2017/08/15 399 795 -51 230
2017/08/14 451 025 -2 973
2017/08/13 453 998 -1 339
2017/08/12 455 337 -36 900
2017/08/11 492 237 +1 214
2017/08/10 491 023 -44 241
2017/08/09 535 264 +42 340
2017/08/08 492 924 +36 665
2017/08/07 456 259 +26 102
2017/08/06 430 157 -35 006
2017/08/05 465 163 -49 974
2017/08/04 515 137 +1 603
2017/08/03 513 534 +47 644
2017/08/02 465 890 +607
2017/08/01 465 283 +10 339
2017/07/31 454 944 -2 515
2017/07/30 457 459 +24 304
2017/07/29 433 155 +60 643
2017/07/28 372 512 -442
2017/07/27 372 954 -12 716
2017/07/26 385 670 +1 940
2017/07/25 383 730 -32 879
2017/07/24 416 609 -1 941
2017/07/23 418 550 +3 187
2017/07/22 415 363 -392
2017/07/21 415 755 -634
2017/07/20 416 389 -82 685
2017/07/19 499 074 +2 372
2017/07/18 496 702 -1 881
2017/07/17 498 583 -2 359
2017/07/16 500 942 -750
2017/07/15 501 692 -316
2017/07/14 502 008 -178
2017/07/13 502 186 +1 959
2017/07/12 500 227 +4 077
2017/07/11 496 150 +46 263
2017/07/10 449 887 +69 253
2017/07/09 380 634 -16 450
2017/07/08 397 084 -19 862
2017/07/07 416 946 -19 476
2017/07/06 436 422 -35 648
2017/07/05 472 070 +51 762
2017/07/04 420 308 -947
2017/07/03 421 255 -12 698
2017/07/02 433 953 -523
2017/07/01 434 476 +15 141
2017/06/30 419 335 -20 008
2017/06/29 439 343 +7 999
2017/06/28 431 344 +4 794
2017/06/27 426 550 +17 865
2017/06/26 408 685 -1 643
2017/06/25 410 328 -481
2017/06/24 410 809 +21 594
2017/06/23 389 215

WIDGET FOR YOUR SITE

DOMAINS WITH THE NEAREST RANK

Domain Rank
rodnaya-tropinka.ru 353 939
tmwsystems.com 353 940
actividadesdeinfantilyprimaria.com 353 941
devoloperxda.blogspot.com 353 942
gruppenhaus.de 353 943
info-mapping.com 353 944
cookwithmanali.com 353 945
natureword.com 353 946
sexy-dressed.com 353 947
learnhotenglish.com 353 948
fuckold.net 353 949

DOMAINS WITH THE NEAREST RANK BY TLD .com

Domain Rank
arminhost.com 353 932
tubezsex.com 353 936
nctechimaging.com 353 938
tmwsystems.com 353 940
actividadesdeinfantilyprimaria.com 353 941
info-mapping.com 353 944
cookwithmanali.com 353 945
natureword.com 353 946
sexy-dressed.com 353 947
learnhotenglish.com 353 948
baatraining.com 353 952