kollegekidd.com alexa rank chart, kollegekidd.com alexa rank daily changes

kollegekidd.com alexa rank chart, kollegekidd.com alexa rank daily changes

kollegekidd.com
Actual rank:
221 996

RANK HISTORY

Date Rank Diff
2018/04/23 221 996 +21 395
2018/04/22 200 601 -129 884
2018/04/21 330 485 +96 294
2018/04/20 234 191 -29 015
2018/04/19 263 206 +52 330
2018/04/18 210 876 +52 817
2018/04/17 158 059 -10 101
2018/04/16 168 160 -67 535
2018/04/15 235 695 +1 590
2018/04/14 234 105 -202 481
2018/04/13 436 586 +198 590
2018/04/12 237 996 -80 760
2018/04/11 318 756 -34 097
2018/04/10 352 853 -257 635
2018/04/09 610 488 +329 318
2018/04/08 281 170 +7 370
2018/04/07 273 800 +135 814
2018/04/06 137 986 -190 345
2018/04/05 328 331 +184 247
2018/04/04 144 084 -15 586
2018/04/03 159 670 -8 963
2018/04/02 168 633 -65 102
2018/04/01 233 735 +44 298
2018/03/31 189 437 +74 613
2018/03/30 114 824 -111 408
2018/03/29 226 232 +13 898
2018/03/28 212 334 +16 263
2018/03/27 196 071 -30 565
2018/03/26 226 636 +40 151
2018/03/25 186 485 -220 932
2018/03/24 407 417 +190 642
2018/03/23 216 775 +71 902
2018/03/22 144 873 -93 480
2018/03/21 238 353 +33 447
2018/03/20 204 906 -97 291
2018/03/19 302 197 -137 486
2018/03/18 439 683 +47 584
2018/03/17 392 099 +143 586
2018/03/16 248 513 +16 285
2018/03/15 232 228 -41 128
2018/03/14 273 356 +119 079
2018/03/13 154 277 -72 233
2018/03/12 226 510 +5 934
2018/03/11 220 576 +29 426
2018/03/10 191 150 +4 435
2018/03/09 186 715 -60 702
2018/03/08 247 417 -65 218
2018/03/07 312 635 +150 972
2018/03/06 161 663 +9 909
2018/03/05 151 754 -309 832
2018/03/04 461 586 +128 753
2018/03/03 332 833 +48 012
2018/03/02 284 821 +94 211
2018/03/01 190 610 -10 362
2018/02/28 200 972 +14 860
2018/02/27 186 112 -6 650
2018/02/26 192 762 -22 769
2018/02/25 215 531 -15 985
2018/02/24 231 516 +74 933
2018/02/23 156 583 -84 945
2018/02/22 241 528

WIDGET FOR YOUR SITE

DOMAINS WITH THE NEAREST RANK

Domain Rank
greeneyeemporia.com 221 991
gsinfo.ch 221 992
htlayer.com 221 993
probst-handling.com 221 994
residencecampi.com 221 995
kollegekidd.com 221 996
aazea.org 221 997
affinage.org.ua 221 998
actividadesdeinfantilyprimaria.com 221 999
afribary.com 222 000
superrugby.co.nz 222 001

DOMAINS WITH THE NEAREST RANK BY TLD .com

Domain Rank
atlasrfidstore.com 221 990
greeneyeemporia.com 221 991
htlayer.com 221 993
probst-handling.com 221 994
residencecampi.com 221 995
kollegekidd.com 221 996
actividadesdeinfantilyprimaria.com 221 999
afribary.com 222 000
playstaxel.com 222 003
lahorerealestate.com 222 004
thegigmobility.com 222 006