mindflash.com alexa rank chart, mindflash.com alexa rank daily changes

mindflash.com alexa rank chart, mindflash.com alexa rank daily changes

mindflash.com
Actual rank:
413 531

RANK HISTORY

Date Rank Diff
2018/06/18 413 531 +282 556
2018/06/17 130 975 +34 791
2018/06/16 96 184 -100 040
2018/06/15 196 224 +86 579
2018/06/14 109 645 -91 002
2018/06/13 200 647 -54 130
2018/06/12 254 777 +77 530
2018/06/11 177 247 +77 142
2018/06/10 100 105 +24 326
2018/06/09 75 779 -13 951
2018/06/08 89 730 -71 879
2018/06/07 161 609 +52 029
2018/06/06 109 580 -270 306
2018/06/05 379 886 -1 853
2018/06/04 381 739 +175 416
2018/06/03 206 323 -14 033
2018/06/02 220 356 +37 028
2018/06/01 183 328 +57 869
2018/05/31 125 459 -125 384
2018/05/30 250 843 -294 969
2018/05/29 545 812 +317 076
2018/05/28 228 736 +153 773
2018/05/27 74 963 -26 602
2018/05/26 101 565 -28 928
2018/05/25 130 493 +26 645
2018/05/24 103 848 -70 467
2018/05/23 174 315 -267 500
2018/05/22 441 815 +216 561
2018/05/21 225 254 +14 220
2018/05/20 211 034 +41 691
2018/05/19 169 343 -12 017
2018/05/18 181 360 +40 150
2018/05/17 141 210 -34 573
2018/05/16 175 783 -248 330
2018/05/15 424 113 +234 423
2018/05/13 189 690 -7 760
2018/05/12 197 450 +126 520
2018/05/11 70 930 -124 943
2018/05/10 195 873 +90 806
2018/05/09 105 067 -99 561
2018/05/08 204 628 -175 414
2018/05/07 380 042 +176 858
2018/05/06 203 184 +20 585
2018/05/05 182 599 +66 719
2018/05/04 115 880 -57 496
2018/05/03 173 376 -3 014
2018/05/02 176 390 -20 780
2018/05/01 197 170 -12 786
2018/04/30 209 956 +53 178
2018/04/29 156 778 -43 931
2018/04/28 200 709 -679 561
2018/04/27 880 270 +756 014
2018/04/26 124 256 +61 779
2018/04/25 62 477 -179 119
2018/04/24 241 596 -638 674
2018/04/23 880 270 +701 828
2018/04/22 178 442 +22 889
2018/04/21 155 553 -107 253
2018/04/20 262 806 +217 064
2018/04/19 45 742

WIDGET FOR YOUR SITE

DOMAINS WITH THE NEAREST RANK

Domain Rank
ourwedding.com.mt 413 526
bonflo.com 413 527
novelas-brasilieras.ru 413 528
pixelgun3d.com 413 529
flonase.ca 413 530
mindflash.com 413 531
stefmar.com.au 413 532
vsemsmart.ru 413 533
gold.ua 413 534
v-vannoy.com 413 535
bestdegreeprograms.org 413 536

DOMAINS WITH THE NEAREST RANK BY TLD .com

Domain Rank
onlinebatterywala.com 413 518
previewsitesmediasmacksiteserver.com 413 519
vipswallet.com 413 521
bonflo.com 413 527
pixelgun3d.com 413 529
mindflash.com 413 531
v-vannoy.com 413 535
alheripath.com 413 539
betdey.com 413 540
businessamlive.com 413 541
nigerianbestforum.com 413 544