openfaves.com alexa rank chart, openfaves.com alexa rank daily changes

openfaves.com alexa rank chart, openfaves.com alexa rank daily changes

openfaves.com
Actual rank:
278 999

RANK HISTORY

Date Rank Diff
2017/09/15 278 999 -4 436
2017/09/14 283 435 -2 604
2017/09/13 286 039 -1 433
2017/09/12 287 472 -2 291
2017/09/11 289 763 -10 357
2017/09/10 300 120 -3 341
2017/09/09 303 461 +17 002
2017/09/08 286 459 -5 152
2017/09/07 291 611 +7 092
2017/09/06 284 519 +242
2017/09/05 284 277 +2 631
2017/09/04 281 646 -5 226
2017/09/03 286 872 -9 051
2017/09/02 295 923 +13 611
2017/09/01 282 312 -2 948
2017/08/31 285 260 -2 821
2017/08/30 288 081 +1 540
2017/08/29 286 541 -913
2017/08/28 287 454 -3 976
2017/08/27 291 430 +9 790
2017/08/26 281 640 +1 970
2017/08/25 279 670 -2 172
2017/08/24 281 842 +10 536
2017/08/23 271 306 +11 271
2017/08/22 260 035 +625
2017/08/21 259 410 -65
2017/08/20 259 475 -3 334
2017/08/19 262 809 -1 911
2017/08/18 264 720 -7 558
2017/08/17 272 278 -794
2017/08/16 273 072 +8 561
2017/08/15 264 511 +3 028
2017/08/14 261 483 +3 618
2017/08/13 257 865 +10 490
2017/08/12 247 375 +764
2017/08/11 246 611 -642
2017/08/10 247 253 +315
2017/08/09 246 938 +1 400
2017/08/08 245 538 +599
2017/08/07 244 939 -2 367
2017/08/06 247 306 -837
2017/08/05 248 143 -673
2017/08/04 248 816 -4 415
2017/08/03 253 231 +4 243
2017/08/02 248 988 -12 852
2017/08/01 261 840 +4 151
2017/07/31 257 689 -8 136
2017/07/30 265 825 -1 513
2017/07/29 267 338 +1 834
2017/07/28 265 504 +12 688
2017/07/27 252 816 -8 461
2017/07/26 261 277 +606
2017/07/25 260 671 -786
2017/07/24 261 457 -2 431
2017/07/23 263 888 -1 086
2017/07/22 264 974 +2 946
2017/07/21 262 028 -602
2017/07/20 262 630 -3 463
2017/07/19 266 093 +5 367
2017/07/18 260 726 +12 282
2017/07/17 248 444

WIDGET FOR YOUR SITE

DOMAINS WITH THE NEAREST RANK

Domain Rank
premudrost.club 278 994
reggaetonsinlimite.com 278 995
walletsurf.com 278 996
cpopowertools.com 278 997
theadvocate.com.au 278 998
openfaves.com 278 999
psychotherapiepraxis.at 279 000
whatsurskill.com 279 001
miz-site.com 279 002
howmuchtomakeanapp.com 279 003
germancarforum.com 279 004

DOMAINS WITH THE NEAREST RANK BY TLD .com

Domain Rank
actividadesdeinfantilyprimaria.com 278 988
timesofsandiego.com 278 992
reggaetonsinlimite.com 278 995
walletsurf.com 278 996
cpopowertools.com 278 997
openfaves.com 278 999
whatsurskill.com 279 001
miz-site.com 279 002
howmuchtomakeanapp.com 279 003
germancarforum.com 279 004
keeptalkinggreece.com 279 005