oss.org.cn alexa rank chart, oss.org.cn alexa rank daily changes

oss.org.cn alexa rank chart, oss.org.cn alexa rank daily changes

oss.org.cn
Actual rank:
393 623

RANK HISTORY

Date Rank Diff
2017/10/19 393 623 +1 234
2017/10/18 392 389 +10 001
2017/10/17 382 388 -1 201
2017/10/16 383 589 -2 260
2017/10/14 385 849 -583
2017/10/13 386 432 +45 557
2017/10/12 340 875 +891
2017/10/11 339 984 +1 300
2017/10/10 338 684 -826
2017/10/09 339 510 +32 290
2017/10/08 307 220 -966
2017/10/07 308 186 -648
2017/10/06 308 834 -536
2017/10/05 309 370 +740
2017/10/04 308 630 +901
2017/10/03 307 729 -53 257
2017/10/02 360 986 -1 530
2017/10/01 362 516 -11 210
2017/09/30 373 726 -623
2017/09/29 374 349 +53 948
2017/09/28 320 401 +34 152
2017/09/27 286 249 -26 301
2017/09/26 312 550 -966
2017/09/25 313 516 -42 014
2017/09/24 355 530 -542
2017/09/23 356 072 -59 743
2017/09/22 415 815 +1 751
2017/09/20 414 064 +640
2017/09/19 413 424 -1 332
2017/09/18 414 756 -89 054
2017/09/17 503 810 +77 506
2017/09/16 426 304 +201
2017/09/15 426 103 +63 542
2017/09/14 362 561 +2 305
2017/09/13 360 256 -49 082
2017/09/12 409 338 -1 113
2017/09/11 410 451 -1 575
2017/09/10 412 026 -500
2017/09/09 412 526 -64 165
2017/09/08 476 691 +2 549
2017/09/07 474 142 +78 995
2017/09/06 395 147 +636
2017/09/05 394 511 -1 281
2017/09/04 395 792 -1 654
2017/09/03 397 446 -827
2017/09/02 398 273 +48 937
2017/09/01 349 336 +43 801
2017/08/31 305 535 +29 509
2017/08/30 276 026 +549
2017/08/29 275 477 -8 863
2017/08/28 284 340 -33 984
2017/08/27 318 324 -459
2017/08/26 318 783 +51 919
2017/08/25 266 864 +1 009
2017/08/24 265 855 +1 391
2017/08/23 264 464 +328
2017/08/22 264 136 +18 539
2017/08/21 245 597 -1 230
2017/08/20 246 827

WIDGET FOR YOUR SITE

DOMAINS WITH THE NEAREST RANK

Domain Rank
unsubscribe.net.in 393 618
svetaci.info 393 619
mir-la.com 393 620
actividadesdeinfantilyprimaria.com 393 621
musetips.com 393 622
oss.org.cn 393 623
caixabankequipment.com 393 624
dn-24.com 393 625
uniana.com 393 626
gicare.com 393 627
musiccircle.ru 393 628

DOMAINS WITH THE NEAREST RANK BY TLD .org.cn

Domain Rank
farmers.org.cn 385 267
cafta.org.cn 386 495
jtzyzg.org.cn 390 326
emagic.org.cn 390 459
oss.org.cn 393 623
eusmecentre.org.cn 393 928
imsa.org.cn 394 159
ntp.org.cn 395 727
cfdoctor.org.cn 396 994
ebs.org.cn 397 994