plusquelinfo.com alexa rank chart, plusquelinfo.com alexa rank daily changes

plusquelinfo.com alexa rank chart, plusquelinfo.com alexa rank daily changes

plusquelinfo.com
Actual rank:
181 489

RANK HISTORY

Date Rank Diff
2018/02/23 181 489 +15 331
2018/02/22 166 158 -19 995
2018/02/21 186 153 +98 743
2018/02/18 87 410 -30 682
2018/02/17 118 092 +16 959
2018/02/16 101 133 -131 503
2018/02/15 232 636 +42 140
2018/02/14 190 496 -199 767
2018/02/11 390 263 +264 088
2018/02/10 126 175 -106 410
2018/02/09 232 585 +120 450
2018/02/08 112 135 -8 896
2018/02/07 121 031 -8 241
2018/02/04 129 272 +58 249
2018/02/03 71 023 -58 990
2018/02/02 130 013 +13 929
2018/02/01 116 084 +21 314
2018/01/31 94 770 -108 682
2018/01/30 203 452 +5 153
2018/01/29 198 299 +5 939
2018/01/28 192 360 -7 551
2018/01/27 199 911 -7 818
2018/01/26 207 729 -8 769
2018/01/25 216 498 -8 505
2018/01/24 225 003 +1 704
2018/01/23 223 299 +9 183
2018/01/22 214 116 +4 983
2018/01/21 209 133 +659
2018/01/20 208 474 +7 126
2018/01/19 201 348 -4 000
2018/01/18 205 348 -16 714
2018/01/17 222 062 -4 147
2018/01/16 226 209 +13 620
2018/01/15 212 589 +8 540
2018/01/14 204 049 +5 998
2018/01/13 198 051 +4 473
2018/01/12 193 578 -3 876
2018/01/11 197 454 -5 425
2018/01/10 202 879 +1 781
2018/01/09 201 098 +17 844
2018/01/08 183 254 +6 298
2018/01/07 176 956 +3 395
2018/01/06 173 561 +4 157
2018/01/05 169 404 -9 027
2018/01/04 178 431 -1 408
2018/01/03 179 839 +6 475
2018/01/02 173 364 +6 589
2018/01/01 166 775 +3 956
2017/12/31 162 819 +4 254
2017/12/30 158 565 +2 375
2017/12/29 156 190 +5 671
2017/12/28 150 519 -722
2017/12/27 151 241 -222
2017/12/26 151 463 +8 121
2017/12/25 143 342

WIDGET FOR YOUR SITE

DOMAINS WITH THE NEAREST RANK

Domain Rank
farmlend.ru 181 484
irgups.ru 181 485
blablawriting.com 181 486
mahiroffice.com 181 487
meretdemeures.com 181 488
plusquelinfo.com 181 489
actividadesdeinfantilyprimaria.com 181 490
kingsofteens.com 181 491
ivanovo.ru 181 492
mytrendin.com 181 493
bystrobank.ru 181 494

DOMAINS WITH THE NEAREST RANK BY TLD .com

Domain Rank
carminashoemaker.com 181 480
newgradoptometry.com 181 481
blablawriting.com 181 486
mahiroffice.com 181 487
meretdemeures.com 181 488
plusquelinfo.com 181 489
actividadesdeinfantilyprimaria.com 181 490
kingsofteens.com 181 491
mytrendin.com 181 493
tntiran.com 181 495
tvarenasport.com 181 497