royalsreview.com alexa rank chart, royalsreview.com alexa rank daily changes

royalsreview.com alexa rank chart, royalsreview.com alexa rank daily changes

royalsreview.com
Actual rank:
219 859

RANK HISTORY

Date Rank Diff
2017/11/22 219 859 -394
2017/11/21 220 253 +6 814
2017/11/20 213 439 -1 930
2017/11/19 215 369 -2 600
2017/11/18 217 969 -3 349
2017/11/17 221 318 -5 665
2017/11/16 226 983 -7 709
2017/11/15 234 692 -4 126
2017/11/14 238 818 +1 703
2017/11/13 237 115 -525
2017/11/12 237 640 -2 036
2017/11/11 239 676 +2 709
2017/11/10 236 967 -7 419
2017/11/09 244 386 -4 655
2017/11/08 249 041 +3 969
2017/11/07 245 072 +11 892
2017/11/06 233 180 -6 592
2017/11/05 239 772 -2 758
2017/11/04 242 530 +2 796
2017/11/03 239 734 +5 073
2017/11/02 234 661 +2 033
2017/11/01 232 628 -1 130
2017/10/31 233 758 +5 510
2017/10/30 228 248 +4 037
2017/10/29 224 211 +900
2017/10/28 223 311 -917
2017/10/27 224 228 +4 118
2017/10/26 220 110 +3 828
2017/10/25 216 282 +5 170
2017/10/24 211 112 +2 242
2017/10/23 208 870 +4 192
2017/10/22 204 678 +6 260
2017/10/21 198 418 +2 509
2017/10/20 195 909 +6 525
2017/10/19 189 384 -1 955
2017/10/18 191 339 +2 882
2017/10/17 188 457 +9 528
2017/10/16 178 929 +3 326
2017/10/14 175 603 +2 714
2017/10/13 172 889 -594
2017/10/12 173 483 -1 601
2017/10/11 175 084 +992
2017/10/10 174 092 +3 175
2017/10/09 170 917 -14
2017/10/08 170 931 -4 681
2017/10/07 175 612 -2 594
2017/10/06 178 206 -2 284
2017/10/05 180 490 +3 062
2017/10/04 177 428 -1 944
2017/10/03 179 372 -48
2017/10/02 179 420 +3 054
2017/10/01 176 366 +8 971
2017/09/30 167 395 -1 698
2017/09/29 169 093 +1 705
2017/09/28 167 388 +1 435
2017/09/27 165 953 +1 418
2017/09/26 164 535 +3 044
2017/09/25 161 491 +2 034
2017/09/24 159 457 +382
2017/09/23 159 075

WIDGET FOR YOUR SITE

DOMAINS WITH THE NEAREST RANK

Domain Rank
webbax.ch 219 854
poczta-online.com 219 855
actividadesdeinfantilyprimaria.com 219 856
texturify.com 219 857
sanusworld.com 219 858
royalsreview.com 219 859
2gis.cl 219 860
vanarama.co.uk 219 861
bobqu.net 219 862
enfield.gov.uk 219 863
oga.gr 219 864

DOMAINS WITH THE NEAREST RANK BY TLD .com

Domain Rank
165123.com 219 853
poczta-online.com 219 855
actividadesdeinfantilyprimaria.com 219 856
texturify.com 219 857
sanusworld.com 219 858
royalsreview.com 219 859
linksprite.com 219 865
scoophot.com 219 868
soclean.com 219 872
fxcmespanol.com 219 877
asancard.com 219 879