utema.ru alexa rank chart, utema.ru alexa rank daily changes

utema.ru alexa rank chart, utema.ru alexa rank daily changes

utema.ru
Actual rank:
262 698

RANK HISTORY

Date Rank Diff
2017/09/22 262 698 -255
2017/09/20 262 953 +2 061
2017/09/19 260 892 -438
2017/09/18 261 330 -3 346
2017/09/17 264 676 -344
2017/09/16 265 020 +474
2017/09/15 264 546 +1 763
2017/09/14 262 783 -3 862
2017/09/13 266 645 -4 995
2017/09/12 271 640 -4 665
2017/09/11 276 305 -4 621
2017/09/10 280 926 -4 592
2017/09/09 285 518 -3 336
2017/09/08 288 854 +5 441
2017/09/07 283 413 +3 249
2017/09/06 280 164 +2 033
2017/09/05 278 131 -1 879
2017/09/04 280 010 -2 795
2017/09/03 282 805 -952
2017/09/02 283 757 +6 452
2017/09/01 277 305 +5 715
2017/08/31 271 590 +3 921
2017/08/30 267 669 +7 359
2017/08/29 260 310 +1 030
2017/08/28 259 280 +8 394
2017/08/27 250 886 -473
2017/08/26 251 359 +210
2017/08/25 251 149 +2 975
2017/08/24 248 174 +2 774
2017/08/23 245 400 -3 590
2017/08/22 248 990 -660
2017/08/21 249 650 +860
2017/08/20 248 790 +2 679
2017/08/19 246 111 +731
2017/08/18 245 380 +2 793
2017/08/17 242 587 +3 639
2017/08/16 238 948 -111
2017/08/15 239 059 +1 317
2017/08/14 237 742 +2 791
2017/08/13 234 951 +4 034
2017/08/12 230 917 -1 451
2017/08/11 232 368 +2 789
2017/08/10 229 579 +2 479
2017/08/09 227 100 -778
2017/08/08 227 878 -904
2017/08/07 228 782 +4 531
2017/08/06 224 251 -1 053
2017/08/05 225 304 +1 419
2017/08/04 223 885 +780
2017/08/03 223 105 +3 398
2017/08/02 219 707 +1 869
2017/08/01 217 838 +173
2017/07/31 217 665 +2 472
2017/07/30 215 193 -900
2017/07/29 216 093 -276
2017/07/28 216 369 -6 339
2017/07/27 222 708 -84
2017/07/26 222 792 +1 052
2017/07/25 221 740 +876
2017/07/24 220 864

WIDGET FOR YOUR SITE

DOMAINS WITH THE NEAREST RANK

Domain Rank
freenom.cf 262 693
spyrix.com 262 694
lyu.edu.cn 262 695
paymentmethodselection.com 262 696
actividadesdeinfantilyprimaria.com 262 697
utema.ru 262 698
pmob.me 262 699
yuyuyu.tv 262 700
thetop10.cn 262 701
yamaha-motor.com.ph 262 702
traq.com 262 703

DOMAINS WITH THE NEAREST RANK BY TLD .ru

Domain Rank
u-uk.ru 262 652
imhonet.ru 262 656
pragagid.ru 262 660
gaimoritus.ru 262 663
termofor.ru 262 682
utema.ru 262 698
ruskarec.ru 262 710
mistakes.ru 262 718
sevdol.ru 262 762
belive.ru 262 775
banki-v.ru 262 781